PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0695s0014.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 419aa    MW: 46636.9 Da    PI: 9.0905
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0695s0014.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94e-32237290255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Kalax.0695s0014.2.p 237 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 290
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-28234290IPR009057Homeodomain-like
SuperFamilySSF466893.4E-15235290IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23237290IPR006447Myb domain, plants
PfamPF002497.5E-7238289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MELFPAQPDL SLLISPPSST TKPNHTALLW PHTSRSSDHE QVVDEEDQEQ NSDLGFWNRA  60
LNNNNPSTIL SKQQTGPNPV PSNISFSNPS IRASSSSSPK SSNITYFPHH QLLHTSPLPN  120
PNNLHHQATM IAQNQEQLGY MNMKPIRGIP IYHQNSAHRR HPFTASTFPH QHQSLLLNSI  180
PSLPSSISNT NSCSSINGSL ASPAYCFQSS HNQNYHNGFV RSRFLSRFPG KKNTRAPRMR  240
WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDRAAAT  300
SDAYENGSSG DNSEDMMLDI QSSARKQSDQ LHQQSISSAA GRPNAQQDKD CQALWSNSSR  360
EARLHAGKPK DSYQGTIASL QDMDDSRCLS FYERSSEEII IGRIMKKPNL EFTLGRAL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075104.16e-97PREDICTED: probable transcription factor KAN2 isoform X4
TrEMBLA0A067KUB84e-95A0A067KUB8_JATCU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-62G2-like family protein